PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G065900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 296aa    MW: 32264.8 Da    PI: 8.7712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G065900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.68.5e-5291331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL+++++g ++ +  +i+e+d+yk++Pw+Lpk++  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+
  Brast01G065900.1.p   9 LPPGFRFHPTDEELVMHYLCRRCAGAPIAV-PIIAEIDLYKFDPWQLPKMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKP 98 
                         79**************************99.88***************7767789************************************ PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v s   + v +kk Lvfy g+apkgekt+W+mheyrl
  Brast01G065900.1.p  99 VGS--PKPVAIKKALVFYAGKAPKGEKTNWIMHEYRL 133
                         *99..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-626159IPR003441NAC domain
PROSITE profilePS5100559.9099159IPR003441NAC domain
PfamPF023651.2E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSGGQDLQLP PGFRFHPTDE ELVMHYLCRR CAGAPIAVPI IAEIDLYKFD PWQLPKMALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGSGYW KATGADKPVG SPKPVAIKKA LVFYAGKAPK  120
GEKTNWIMHE YRLADVDRSA RKKNSLRLDD WVLCRIYNKK GGLEKPAAAH ADQKPPLLGG  180
YGAAVAMASS PPEQKPLVGP GMAPPAFPDY AAYYDRPSDS MPRLHADSSC SEQAAVLSPD  240
QFPGGGEVQS QPKISEWERS FATVDPVNPA SAGGGLGLGG DPLLQDILMY WGKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-79616512174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ6220930.0HQ622093.1 Elymus repens stress-related NAC transcription factor (NAC7) mRNA, complete cds.
GenBankHQ7382850.0HQ738285.1 Elymus repens stress-related NAM transcription factor (NAC7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564785.10.0PREDICTED: NAC domain-containing protein 48
SwissprotQ7F2L31e-168NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLI1HU190.0I1HU19_BRADI; Uncharacterized protein
STRINGBRADI2G57100.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-115NAC family protein